PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017143P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 337aa    MW: 38221.8 Da    PI: 6.6686
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017143P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     r+ WT+eEd +++ +v ++G+ +W++ +++ g++R++k+c++rw +yl
   MELO3C017143P1 14 RDLWTAEEDAKILAYVSKHGTSNWTSAPKKAGLRRCGKSCRLRWTNYL 61
                     567*******************************************97 PP

2Myb_DNA-binding461.2e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T +E+el++++++  G++ W+ Ia+ ++ gRt++++k++w++
   MELO3C017143P1  68 QNFTSQEEELIIRLHAAIGSR-WAIIAQQLP-GRTDNDVKNYWNT 110
                      79*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.498961IPR017930Myb domain
SuperFamilySSF466891.21E-2811108IPR009057Homeodomain-like
SMARTSM007172.6E-111363IPR001005SANT/Myb domain
PfamPF002491.3E-131561IPR001005SANT/Myb domain
CDDcd001672.07E-91761No hitNo description
Gene3DG3DSA:1.10.10.603.3E-221768IPR009057Homeodomain-like
PROSITE profilePS5129423.06462116IPR017930Myb domain
SMARTSM007171.5E-1366114IPR001005SANT/Myb domain
PfamPF002492.8E-1368110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-2469116IPR009057Homeodomain-like
CDDcd001672.33E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVRIPSCDKL NLKRDLWTAE EDAKILAYVS KHGTSNWTSA PKKAGLRRCG KSCRLRWTNY  60
LRPDLKHQNF TSQEEELIIR LHAAIGSRWA IIAQQLPGRT DNDVKNYWNT KLRRKLSEMG  120
IDPVTHKPFS QILADYGNIG GLPRSTKRIG SLKTGPVMDQ SMNANVHQVN NNHPLNLLAQ  180
LQAMQRVTEA SHCTFNEQIQ PHFYTQSYLP SSSSSSSSST TTVTCRNSSS TFSWQDFLLE  240
DAFLPSEPQE LENVGEFSLN QNGCQTENGI SKEELNKERC DYQYNRFEAT HCLVGNNDIE  300
ASSSSAENTF IETLLHQEDK IILFDFLNLL EEPLYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27111164108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453162.10.0PREDICTED: transcription factor MYB24-like
TrEMBLA0A0A0LP090.0A0A0A0LP09_CUCSA; Uncharacterized protein
STRINGVIT_17s0000g05400.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-69MYB family protein